PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00936.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 335aa    MW: 37766 Da    PI: 5.7467
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00936.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.83.7e-48141392128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                               pGf+F+Ptd el+++yLk+k++g + ++ e+i+e+diy++ePwdLp k++ ++e+ew+fF+ r kky++g++++ratk gyWkat
  Rsa1.0_00936.1_g00005.1  14 FPGFKFSPTDIELISYYLKRKMDGLEKSV-EIIPELDIYNFEPWDLPdKSIVKSESEWFFFCARGKKYPHGSQNRRATKIGYWKAT 98 
                              59************************999.99***************777878899****************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gk+++v+s ++e++g+k+tLvf+ grapkg +t+W+mhey +
  Rsa1.0_00936.1_g00005.1  99 GKERNVKS-GSEVIGTKRTLVFHIGRAPKGGRTEWIMHEYCM 139
                              ********.9******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-525154IPR003441NAC domain
PROSITE profilePS5100550.63613155IPR003441NAC domain
PfamPF023652.0E-2415138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MADTTVSVAV STAFPGFKFS PTDIELISYY LKRKMDGLEK SVEIIPELDI YNFEPWDLPD  60
KSIVKSESEW FFFCARGKKY PHGSQNRRAT KIGYWKATGK ERNVKSGSEV IGTKRTLVFH  120
IGRAPKGGRT EWIMHEYCMI GVSLNALVIC RLRRNTEFQG ATSQKPPPPP QPQPSLSLDK  180
NTNLQNQTVS GWENIVDYYL SGESGHELLS EIAESSQSSH NPQVPSEEDL YADILRDDIV  240
KLDDPADSGN TLIDVPRLQS ESTTTRVLPL PSMVDKQMQS LLQRLPLQND IGEENNISMS  300
GCFIGIYSIK SINRARWDVI TWVLVMIAVL VFYLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-421515519165NO APICAL MERISTEM PROTEIN
1ut4_B8e-421515519165NO APICAL MERISTEM PROTEIN
1ut7_A8e-421515519165NO APICAL MERISTEM PROTEIN
1ut7_B8e-421515519165NO APICAL MERISTEM PROTEIN
3swm_A8e-421515522168NAC domain-containing protein 19
3swm_B8e-421515522168NAC domain-containing protein 19
3swm_C8e-421515522168NAC domain-containing protein 19
3swm_D8e-421515522168NAC domain-containing protein 19
3swp_A8e-421515522168NAC domain-containing protein 19
3swp_B8e-421515522168NAC domain-containing protein 19
3swp_C8e-421515522168NAC domain-containing protein 19
3swp_D8e-421515522168NAC domain-containing protein 19
4dul_A8e-421515519165NAC domain-containing protein 19
4dul_B8e-421515519165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747630.0KF974763.1 Brassica napus NAC transcription factor 60-1 (NAC60-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013639422.10.0PREDICTED: NAC domain-containing protein 60 isoform X1
SwissprotQ9LXL90.0NAC60_ARATH; NAC domain-containing protein 60
TrEMBLA0A078G4K10.0A0A078G4K1_BRANA; BnaC01g23890D protein
TrEMBLA0A0D3A8I00.0A0A0D3A8I0_BRAOL; Uncharacterized protein
STRINGBra021471.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43092356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.10.0NAC domain containing protein 60